Lineage for d1pjba2 (1pjb A:1-135,A:304-361)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465923Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2465987Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 2465988Protein L-alanine dehydrogenase [52298] (1 species)
  7. 2465989Species Phormidium lapideum [TaxId:32060] [52299] (3 PDB entries)
  8. 2465991Domain d1pjba2: 1pjb A:1-135,A:304-361 [31363]
    Other proteins in same PDB: d1pjba1

Details for d1pjba2

PDB Entry: 1pjb (more details), 2.1 Å

PDB Description: l-alanine dehydrogenase
PDB Compounds: (A:) l-alanine dehydrogenase

SCOPe Domain Sequences for d1pjba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjba2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}
meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
lpnrslplltpmsiiXvpwtatqalnnstlpyvvklanqglkaletddalakglnvqahr
lvhpavqqvfpdla

SCOPe Domain Coordinates for d1pjba2:

Click to download the PDB-style file with coordinates for d1pjba2.
(The format of our PDB-style files is described here.)

Timeline for d1pjba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pjba1