Lineage for d1pjba2 (1pjb A:1-135,A:304-361)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) 
Family c.23.12.2: L-alanine dehydrogenase [52297] (1 protein) Protein L-alanine dehydrogenase [52298] (1 species) Species Phormidium lapideum [TaxId:32060] [52299] (3 PDB entries) 
Domain d1pjba2: 1pjb A:1-135,A:304-361 [31363]
Other proteins in same PDB: d1pjba1
Details for d1pjba2
PDB Entry: 1pjb (more details), 2.1 Å
PDB Description: l-alanine dehydrogenase
SCOP Domain Sequences for d1pjba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjba2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum}
meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
lpnrslplltpmsiiXvpwtatqalnnstlpyvvklanqglkaletddalakglnvqahr
lvhpavqqvfpdla
SCOP Domain Coordinates for d1pjba2:
Click to download the PDB-style file with coordinates for d1pjba2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pjba2:
- d1pjba2 appears in SCOP 1.57
- d1pjba2 appears in the current release, SCOPe 2.08
View in 3D
