Lineage for d5ee3a1 (5ee3 A:14-303)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2451887Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2451888Protein automated matches [190123] (144 species)
    not a true protein
  7. 2452700Species Oryza sativa [TaxId:39947] [313619] (4 PDB entries)
  8. 2452705Domain d5ee3a1: 5ee3 A:14-303 [313624]
    Other proteins in same PDB: d5ee3a2, d5ee3b2
    automated match to d2ohfa1
    complexed with anp, cl, epe, mg, so4

Details for d5ee3a1

PDB Entry: 5ee3 (more details), 2.9 Å

PDB Description: complex structure of osychf1 with amp-pnp
PDB Compounds: (A:) Obg-like ATPase 1

SCOPe Domain Sequences for d5ee3a1:

Sequence, based on SEQRES records: (download)

>d5ee3a1 c.37.1.0 (A:14-303) automated matches {Oryza sativa [TaxId: 39947]}
erpilgrfsshlkigivglpnvgkstffnivtklsipaenfpfctidpnearvyvpderf
dwlcqlykpksevsayleindiaglvrgahageglgnaflshiravdgifhvlrafedke
vthiddsvdpvrdletigeelrlkdiefvqnkiddleksmkrsndkqlklehelcekvka
hledgkdvrfgdwksadieilntfqlltakpvvylvnmsekdyqrkknkflpkihawvqe
hggetiipfscaferlladmppdeaakycaenqiasvipkiiktgfaaih

Sequence, based on observed residues (ATOM records): (download)

>d5ee3a1 c.37.1.0 (A:14-303) automated matches {Oryza sativa [TaxId: 39947]}
erpilgrfsshlkigivglpnvgkstffnivtklsipaenfpfctidpnearvyvpderf
dwlcqlykpksevsayleindialgnaflshiravdgifhvlrafedkdsvdpvrdleti
geelrlkdiefvqnkiddleksmkrsndkqlklehelcekvkahledgkdvrfgdwksad
ieilntfqlltakpvvylvnmsekdyqrkknkflpkihawvqehggetiipfscaferll
admppdeaakycaenqiasvipkiiktgfaaih

SCOPe Domain Coordinates for d5ee3a1:

Click to download the PDB-style file with coordinates for d5ee3a1.
(The format of our PDB-style files is described here.)

Timeline for d5ee3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ee3a2