Lineage for d1pjca2 (1pjc A:1-135,A:304-361)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857723Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)
  6. 2857724Protein L-alanine dehydrogenase [52298] (1 species)
  7. 2857725Species Phormidium lapideum [TaxId:32060] [52299] (3 PDB entries)
  8. 2857728Domain d1pjca2: 1pjc A:1-135,A:304-361 [31361]
    Other proteins in same PDB: d1pjca1
    complexed with nad

Details for d1pjca2

PDB Entry: 1pjc (more details), 2 Å

PDB Description: l-alanine dehydrogenase complexed with nad
PDB Compounds: (A:) protein (l-alanine dehydrogenase)

SCOPe Domain Sequences for d1pjca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}
meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
lpnrslplltpmsiiXvpwtatqalnnstlpyvvklanqglkaletddalakglnvqahr
lvhpavqqvfpdla

SCOPe Domain Coordinates for d1pjca2:

Click to download the PDB-style file with coordinates for d1pjca2.
(The format of our PDB-style files is described here.)

Timeline for d1pjca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pjca1