SCOPe 2.08: Domain d1pjca2: 1pjc A:1-135,A:304-361

Lineage for d1pjca2 (1pjc A:1-135,A:304-361)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.2: L-alanine dehydrogenase-like [52297] (2 proteins)

6. Protein L-alanine dehydrogenase [52298] (1 species)

7. Species Phormidium lapideum [TaxId:32060] [52299] (3 PDB entries)

8. Domain d1pjca2: 1pjc A:1-135,A:304-361 [31361]
   Other proteins in same PDB: d1pjca1
   complexed with nad

Details for d1pjca2

PDB Entry: 1pjc, 2 Å

PDB Description: l-alanine dehydrogenase complexed with nad

PDB Compounds: (A:) protein (l-alanine dehydrogenase)

SCOPe Domain Sequences for d1pjca2:

Sequence; same for both SEQRES and ATOM records:

>d1pjca2 c.23.12.2 (A:1-135,A:304-361) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]}
meigvpkeiknqefrvglspssvrtlveaghtvfietqagigagfadqdyvqagaqvvps
akdawsremvvkvkeplpaeydlmqkdqllftylhlaaarelteqlmrvgltaiayetve
lpnrslplltpmsiiXvpwtatqalnnstlpyvvklanqglkaletddalakglnvqahr
lvhpavqqvfpdla

Timeline for d1pjca2:

• d1pjca2 first appeared (with stable ids) in SCOP 1.55
  
• d1pjca2 appears in SCOPe 2.07