Lineage for d2dlda2 (2dld A:1-103,A:301-337)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857659Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2857660Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 2857668Protein D-lactate dehydrogenase [52295] (1 species)
  7. 2857669Species Lactobacillus helveticus [TaxId:1587] [52296] (3 PDB entries)
  8. 2857676Domain d2dlda2: 2dld A:1-103,A:301-337 [31359]
    Other proteins in same PDB: d2dlda1, d2dldb1
    complexed with nai, oxm

Details for d2dlda2

PDB Entry: 2dld (more details), 2.7 Å

PDB Description: d-lactate dehydrogenase complexed with nadh and oxamate
PDB Compounds: (A:) d-lactate dehydrogenase

SCOPe Domain Sequences for d2dlda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dlda2 c.23.12.1 (A:1-103,A:301-337) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]}
mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvysXytthavrnmvvkafnn
nlklingekpdspvalnknkf

SCOPe Domain Coordinates for d2dlda2:

Click to download the PDB-style file with coordinates for d2dlda2.
(The format of our PDB-style files is described here.)

Timeline for d2dlda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dlda1