![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
![]() | Protein Phosphoglycerate dehydrogenase [52293] (1 species) has additional C-terminal domain of the ferredoxin fold |
![]() | Species Escherichia coli [TaxId:562] [52294] (1 PDB entry) |
![]() | Domain d1psdb2: 1psd B:7-107,B:296-326 [31358] Other proteins in same PDB: d1psda1, d1psda3, d1psdb1, d1psdb3 complexed with nad |
PDB Entry: 1psd (more details), 2.75 Å
SCOP Domain Sequences for d1psdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1psdb2 c.23.12.1 (B:7-107,B:296-326) Phosphoglycerate dehydrogenase {Escherichia coli} ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli kysdngstlsavn
Timeline for d1psdb2: