Lineage for d5e6la_ (5e6l A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2074741Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2074742Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 2074755Protein Influenza neuraminidase [50943] (4 species)
  7. 2074766Species Influenza A virus, different strains [TaxId:11320] [50944] (78 PDB entries)
    Uniprot P03472 84-470
  8. 2074861Domain d5e6la_: 5e6l A: [313579]
    automated match to d1f8ea_
    complexed with 5ku, bma, ca, man, nag

Details for d5e6la_

PDB Entry: 5e6l (more details), 2.1 Å

PDB Description: structure-based tetravalent zanamivir with potent anti-influenza activity
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d5e6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e6la_ b.68.1.1 (A:) Influenza neuraminidase {Influenza A virus, different strains [TaxId: 11320]}
rnfnnltkglctinswhiygkdnavrigessdvlvtrepyvscdpdecrfyalsqgttir
gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgksrmsicisgpnnn
asavvwynrrpvaeintwarnilrtqesecvchngvcpvvftdgsatgpadtriyyfkeg
kilkwesltgtakhieecscygertgitctckdnwqgsnrpviqidpvamthtsqyicsp
vltdnprpndpnigkcndpypgnnnngvkgfsyldgantwlgrtistasrsgyemlkvpn
altddrskpiqgqtivlnadwsgysgsfmdywaegdcyracfyvelirgrpkedkvwwts
nsivsmcssteflgqwnwpdgakieyfl

SCOPe Domain Coordinates for d5e6la_:

Click to download the PDB-style file with coordinates for d5e6la_.
(The format of our PDB-style files is described here.)

Timeline for d5e6la_:

  • d5e6la_ appears in periodic updates to SCOPe 2.06 starting on 2016-04-14
  • d5e6la_ became obsolete in SCOPe 2.07