Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5d7jh1: 5d7j H:3-115 [313569] Other proteins in same PDB: d5d7ja2, d5d7jc1, d5d7jd_, d5d7je1, d5d7jf1, d5d7jf2, d5d7jg2 automated match to d3q5ya1 complexed with 2lj, gol |
PDB Entry: 5d7j (more details), 1.97 Å
SCOPe Domain Sequences for d5d7jh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d7jh1 b.1.1.0 (H:3-115) automated matches {Human (Homo sapiens) [TaxId: 9606]} gitqaptsqilaagrrmtlrctqdmrhnamywyrqdlglglrlihysntagttgkgevpd gysvsrantddfpltlasavpsqtsvyfcasseaggntgelffgegsrltvle
Timeline for d5d7jh1: