SCOP 1.63: Domain d1gdhb2: 1gdh B:2-100,B:292-321

Lineage for d1gdhb2 (1gdh B:2-100,B:292-321)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families)

5. Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
   this domain is interrupted by the Rossmann-fold domain

6. Protein D-glycerate dehydrogenase [52291] (1 species)

7. Species Hyphomicrobium methylovorum [TaxId:84] [52292] (1 PDB entry)

8. Domain d1gdhb2: 1gdh B:2-100,B:292-321 [31356]
   Other proteins in same PDB: d1gdha1, d1gdhb1
   complexed with so4

Details for d1gdhb2

PDB Entry: 1gdh, 2.4 Å

PDB Description: crystal structure of a nad-dependent d-glycerate dehydrogenase at 2.4 angstroms resolution

SCOP Domain Sequences for d1gdhb2:

Sequence; same for both SEQRES and ATOM records:

>d1gdhb2 c.23.12.1 (B:2-100,B:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum}
kkkilitwplpeaamararesydviahgddpkitidemietaksvdallitlnekcrkev
idripenikcistysigfdhidldackargikvgnaphgXatqaredmahqandlidalf
ggadmsyala

Timeline for d1gdhb2:

• d1gdhb2 first appeared (with stable ids) in SCOP 1.55
  
• d1gdhb2 appears in SCOP 1.61
  
• d1gdhb2 appears in SCOP 1.65
  
• d1gdhb2 appears in the current release, SCOPe 2.08