SCOPe 2.06: Domain d5e2tl1: 5e2t L:1-111

Lineage for d5e2tl1 (5e2t L:1-111)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5e2tl1: 5e2t L:1-111 [313551]
   Other proteins in same PDB: d5e2tl2
   automated match to d1dn0a1
   complexed with ca

Details for d5e2tl1

PDB Entry: 5e2t, 2.1 Å

PDB Description: crystal structure of anti-tau antibody at8 fab

PDB Compounds: (L:) at8 light chain

SCOPe Domain Sequences for d5e2tl1:

Sequence; same for both SEQRES and ATOM records:

>d5e2tl1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqaapsvpvtpgesvsiscrssksllhsngntylywflqrpgqspqllihrmsnla
sgvpdrfsgsgsgtaftlrisrveaedvgvyycmqhleypytfgggtrlev

Timeline for d5e2tl1:

• d5e2tl1 is new in SCOPe 2.06-stable
  
• d5e2tl1 appears in SCOPe 2.07
  
• d5e2tl1 appears in the current release, SCOPe 2.08