Lineage for d1dxy_2 (1dxy 1-100,300-330)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390873Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 391407Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 391408Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 391409Protein D-2-hydroxyisocaproate dehydrogenase [52289] (1 species)
  7. 391410Species Lactobacillus casei [TaxId:1582] [52290] (1 PDB entry)
  8. 391411Domain d1dxy_2: 1dxy 1-100,300-330 [31354]
    Other proteins in same PDB: d1dxy_1
    complexed with coi, nad, so4

Details for d1dxy_2

PDB Entry: 1dxy (more details), 1.9 Å

PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase

SCOP Domain Sequences for d1dxy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxy_2 c.23.12.1 (1-100,300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei}
mkiiaygarvdeiqyfkqwakdtgntleyhtefldentvewakgfdginslqttpyaagv
fekmhaygikfltirnvgtdnidmtamkqygirlsnvpayXtetavhnmvyfslqhlvdf
ltkgetstevtg

SCOP Domain Coordinates for d1dxy_2:

Click to download the PDB-style file with coordinates for d1dxy_2.
(The format of our PDB-style files is described here.)

Timeline for d1dxy_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dxy_1