Lineage for d1dxy_2 (1dxy 1-100,300-330)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120688Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 120689Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (6 proteins)
  6. 120690Protein D-2-hydroxyisocaproate dehydrogenase [52289] (1 species)
  7. 120691Species Lactobacillus casei [TaxId:1582] [52290] (1 PDB entry)
  8. 120692Domain d1dxy_2: 1dxy 1-100,300-330 [31354]
    Other proteins in same PDB: d1dxy_1

Details for d1dxy_2

PDB Entry: 1dxy (more details), 1.9 Å

PDB Description: structure of d-2-hydroxyisocaproate dehydrogenase

SCOP Domain Sequences for d1dxy_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxy_2 c.23.12.1 (1-100,300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei}
mkiiaygarvdeiqyfkqwakdtgntleyhtefldentvewakgfdginslqttpyaagv
fekmhaygikfltirnvgtdnidmtamkqygirlsnvpayXtetavhnmvyfslqhlvdf
ltkgetstevtg

SCOP Domain Coordinates for d1dxy_2:

Click to download the PDB-style file with coordinates for d1dxy_2.
(The format of our PDB-style files is described here.)

Timeline for d1dxy_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dxy_1