Lineage for d5dvzd_ (5dvz D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157154Protein automated matches [190054] (13 species)
    not a true protein
  7. 2157183Species Pyrococcus furiosus [TaxId:186497] [279274] (6 PDB entries)
  8. 2157195Domain d5dvzd_: 5dvz D: [313513]
    automated match to d5dw0a_
    complexed with na, po4

Details for d5dvzd_

PDB Entry: 5dvz (more details), 1.69 Å

PDB Description: holo trpb from pyrococcus furiosus
PDB Compounds: (D:) Tryptophan synthase beta chain 1

SCOPe Domain Sequences for d5dvzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dvzd_ c.79.1.1 (D:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mwfgefggqyvpetlieplkelekaykrfkddeefnrqlnyylktwagrptplyyakrlt
ekiggakiylkredlvhggahktnnaigqallakfmgktrliaetgagqhgvatamagal
lgmkvdiymgaedverqkmnvfrmkllganvipvnsgsrtlkdainealrdwvatfeyth
yligsvvgphpyptivrdfqsvigreakaqileaegqlpdvivacvgggsnamgifypfv
ndkkvklvgveaggkglesgkhsaslnagqvgvfhgmlsyflqdeegqikpthsiapgld
ypgvgpehaylkkiqraeyvtvtdeealkafhelsrtegiipalesahavayamklakem
srdeiiivnlsgrgdkdldivlkvs

SCOPe Domain Coordinates for d5dvzd_:

Click to download the PDB-style file with coordinates for d5dvzd_.
(The format of our PDB-style files is described here.)

Timeline for d5dvzd_: