SCOPe 2.08: Domain d5d7ig2: 5d7i G:111-198

Lineage for d5d7ig2 (5d7i G:111-198)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5d7ig2: 5d7i G:111-198 [313508]
   Other proteins in same PDB: d5d7ia1, d5d7ia2, d5d7ib_, d5d7ic1, d5d7ic2, d5d7id_, d5d7ie1, d5d7if1, d5d7if2, d5d7ig1, d5d7ih1, d5d7ih2
   automated match to d2f54d2
   complexed with 30w, gol, pro

Details for d5d7ig2

PDB Entry: 5d7i, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr

PDB Compounds: (G:) M33.64 TCR Alpha Chain

SCOPe Domain Sequences for d5d7ig2:

Sequence; same for both SEQRES and ATOM records:

>d5d7ig2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Timeline for d5d7ig2:

• d5d7ig2 first appeared in SCOPe 2.06
  
• d5d7ig2 appears in SCOPe 2.07