SCOPe 2.06: Domain d5dtwc1: 5dtw C:1-243

Lineage for d5dtwc1 (5dtw C:1-243)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)

8. Domain d5dtwc1: 5dtw C:1-243 [313497]
   Other proteins in same PDB: d5dtwa2, d5dtwb2, d5dtwc2, d5dtwd2, d5dtwe2, d5dtwf2
   automated match to d3he2a_
   complexed with 5f9

Details for d5dtwc1

PDB Entry: 5dtw, 2.44 Å

PDB Description: crystal structure of m. tuberculosis echa6 bound to c20-coa

PDB Compounds: (C:) enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5dtwc1:

Sequence; same for both SEQRES and ATOM records:

>d5dtwc1 c.14.1.0 (C:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

Timeline for d5dtwc1:

• d5dtwc1 is new in SCOPe 2.06-stable
  
• d5dtwc1 appears in SCOPe 2.07
  
• d5dtwc1 appears in the current release, SCOPe 2.08