Lineage for d5d5ma1 (5d5m A:1-178)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 2507608Domain d5d5ma1: 5d5m A:1-178 [313473]
    Other proteins in same PDB: d5d5ma2, d5d5mb_, d5d5mc2, d5d5md1, d5d5md2, d5d5me1, d5d5me2, d5d5mf1, d5d5mf2, d5d5mg1, d5d5mg2, d5d5mh1, d5d5mh2
    automated match to d4l4va1
    complexed with 2lj, act, gol

Details for d5d5ma1

PDB Entry: 5d5m (more details), 2.2 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5d5ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d5ma1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5d5ma1:

Click to download the PDB-style file with coordinates for d5d5ma1.
(The format of our PDB-style files is described here.)

Timeline for d5d5ma1: