Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (57 PDB entries) Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d5d6da1: 5d6d A:236-339 [313467] Other proteins in same PDB: d5d6da2, d5d6db2, d5d6dc1, d5d6dc2 automated match to d1hzhh3 complexed with bma, fuc, ful, gal, man, nag |
PDB Entry: 5d6d (more details), 3.13 Å
SCOPe Domain Sequences for d5d6da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d6da1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} agpdvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq ynstyrvvsvltvlhqdwlngkeykckvsnkalplpeektiska
Timeline for d5d6da1:
View in 3D Domains from other chains: (mouse over for more information) d5d6db1, d5d6db2, d5d6dc1, d5d6dc2 |