Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins) Pfam PF00866 |
Protein automated matches [190223] (5 species) not a true protein |
Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries) |
Domain d5aeud_: 5aeu D: [313406] Other proteins in same PDB: d5aeua1, d5aeua2, d5aeuc1, d5aeuc2, d5aeue1, d5aeue2, d5aeug1, d5aeug2 automated match to d2xsob_ complexed with fe2, fes |
PDB Entry: 5aeu (more details), 2.49 Å
SCOPe Domain Sequences for d5aeud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aeud_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]} hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm ff
Timeline for d5aeud_: