Lineage for d5aeud_ (5aeu D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936608Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2936664Protein automated matches [190223] (5 species)
    not a true protein
  7. 2936665Species Burkholderia xenovorans [TaxId:266265] [189543] (9 PDB entries)
  8. 2936739Domain d5aeud_: 5aeu D: [313406]
    Other proteins in same PDB: d5aeua1, d5aeua2, d5aeuc1, d5aeuc2, d5aeue1, d5aeue2, d5aeug1, d5aeug2
    automated match to d2xsob_
    complexed with fe2, fes

Details for d5aeud_

PDB Entry: 5aeu (more details), 2.49 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400
PDB Compounds: (D:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d5aeud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aeud_ d.17.4.4 (D:) automated matches {Burkholderia xenovorans [TaxId: 266265]}
hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi
regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd
tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm
ff

SCOPe Domain Coordinates for d5aeud_:

Click to download the PDB-style file with coordinates for d5aeud_.
(The format of our PDB-style files is described here.)

Timeline for d5aeud_: