Lineage for d5ctwb_ (5ctw B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213674Species Staphylococcus aureus [TaxId:1280] [232247] (19 PDB entries)
  8. 2213684Domain d5ctwb_: 5ctw B: [313395]
    automated match to d3u2ka_

Details for d5ctwb_

PDB Entry: 5ctw (more details), 1.48 Å

PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d5ctwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ctwb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
gqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnw
ikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpq
fdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderde
envredsyhyeg

SCOPe Domain Coordinates for d5ctwb_:

Click to download the PDB-style file with coordinates for d5ctwb_.
(The format of our PDB-style files is described here.)

Timeline for d5ctwb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ctwa_