Lineage for d5d7ic1 (5d7i C:1-178)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 2507581Domain d5d7ic1: 5d7i C:1-178 [313374]
    Other proteins in same PDB: d5d7ia2, d5d7ib_, d5d7ic2, d5d7id_, d5d7ie1, d5d7ie2, d5d7if1, d5d7if2, d5d7ig1, d5d7ig2, d5d7ih1, d5d7ih2
    automated match to d4l4va1
    complexed with 30w, gol, pro

Details for d5d7ic1

PDB Entry: 5d7i (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5d7ic1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d7ic1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d5d7ic1:

Click to download the PDB-style file with coordinates for d5d7ic1.
(The format of our PDB-style files is described here.)

Timeline for d5d7ic1: