SCOPe 2.08: Domain d5dc4b_: 5dc4 B:

Lineage for d5dc4b_ (5dc4 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d5dc4b_: 5dc4 B: [313364]
   Other proteins in same PDB: d5dc4a_
   automated match to d3k2mc_
   complexed with gol

Details for d5dc4b_

PDB Entry: 5dc4, 1.48 Å

PDB Description: crystal structure of monobody as25/abl1 sh2 domain complex, crystal a

PDB Compounds: (B:) AS25 monobody

SCOPe Domain Sequences for d5dc4b_:

Sequence; same for both SEQRES and ATOM records:

>d5dc4b_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdvptklevvaatptslliswdapavtvdyyvitygetggwsgyqefevpgskstatisg
lspgvdytitvyaygypyvkynkspisinyrt

Timeline for d5dc4b_:

• d5dc4b_ first appeared in SCOPe 2.06
  
• d5dc4b_ appears in SCOPe 2.07