Lineage for d5d4ya_ (5d4y A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095404Species Capra hircus [TaxId:9925] [313362] (1 PDB entry)
  8. 2095405Domain d5d4ya_: 5d4y A: [313363]
    automated match to d2depb_

Details for d5d4ya_

PDB Entry: 5d4y (more details)

PDB Description: a psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d5d4ya_:

Sequence, based on SEQRES records: (download)

>d5d4ya_ c.1.8.0 (A:) automated matches {Capra hircus [TaxId: 9925]}
qglkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnwed
adkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeefyanmkhhiqaivnryk
dvvycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndy
ndaepaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihl
teldirinedmggglrfnqgqatvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsd
kdswlgvrnypllfdenykpkqaynavknfd

Sequence, based on observed residues (ATOM records): (download)

>d5d4ya_ c.1.8.0 (A:) automated matches {Capra hircus [TaxId: 9925]}
qglkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnwed
adkiadfcrangikmrghtlmwhsqigswmyqgnllskeefyanmkhhiqaivnrykdvv
ycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndynda
epaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihltel
dirinevsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdkdswlgvrnypllfden
ykpkqaynavknfd

SCOPe Domain Coordinates for d5d4ya_:

Click to download the PDB-style file with coordinates for d5d4ya_.
(The format of our PDB-style files is described here.)

Timeline for d5d4ya_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5d4yb_