SCOPe 2.08: Domain d5dc9a_: 5dc9 A:

Lineage for d5dc9a_ (5dc9 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)

8. Domain d5dc9a_: 5dc9 A: [313361]
   Other proteins in same PDB: d5dc9b_
   automated match to d3uyoa_
   complexed with gol, imd

Details for d5dc9a_

PDB Entry: 5dc9, 1.56 Å

PDB Description: crystal structure of monobody as25/abl1 sh2 domain complex, crystal b

PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d5dc9a_:

Sequence; same for both SEQRES and ATOM records:

>d5dc9a_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypapkr

Timeline for d5dc9a_:

• d5dc9a_ first appeared in SCOPe 2.06
  
• d5dc9a_ appears in SCOPe 2.07