SCOPe 2.06: Domain d5dc0b_: 5dc0 B:

Lineage for d5dc0b_ (5dc0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries)

8. Domain d5dc0b_: 5dc0 B: [313352]
   Other proteins in same PDB: d5dc0a_
   automated match to d3uyoa_

Details for d5dc0b_

PDB Entry: 5dc0

PDB Description: crystal structure of monobody gg3/abl1 sh2 domain complex

PDB Compounds: (B:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d5dc0b_:

Sequence; same for both SEQRES and ATOM records:

>d5dc0b_ d.93.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasd
gklyvssesrfntlaelvhhhstvadglittlhypapk

Timeline for d5dc0b_:

• d5dc0b_ is new in SCOPe 2.06-stable
  
• d5dc0b_ appears in SCOPe 2.07
  
• d5dc0b_ appears in the current release, SCOPe 2.08