Lineage for d5d5mf2 (5d5m F:116-242)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1180 PDB entries)
  8. 2356468Domain d5d5mf2: 5d5m F:116-242 [313344]
    Other proteins in same PDB: d5d5ma1, d5d5mb_, d5d5mc1, d5d5md1, d5d5md2, d5d5me2, d5d5mg2
    automated match to d3q5ya2
    complexed with 2lj, act, gol

Details for d5d5mf2

PDB Entry: 5d5m (more details), 2.2 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait m33.64 tcr
PDB Compounds: (F:) M33.64 TCR Beta Chain

SCOPe Domain Sequences for d5d5mf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d5mf2 b.1.1.0 (F:116-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr

SCOPe Domain Coordinates for d5d5mf2:

Click to download the PDB-style file with coordinates for d5d5mf2.
(The format of our PDB-style files is described here.)

Timeline for d5d5mf2: