Lineage for d5db0a1 (5db0 A:2-230)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2243747Fold d.389: Menin N-terminal domain-like [310556] (1 superfamily)
    Some structural similarity to cysteine proteinases (d.3.1.4) noted in PubMed 22327296
  4. 2243748Superfamily d.389.1: Menin N-terminal domain-like [310582] (1 family) (S)
    Pfam PF05053
  5. 2243749Family d.389.1.1: Menin N-terminal domain-like [310623] (1 protein)
  6. 2243750Protein Menin N-terminal domain [310724] (2 species)
  7. 2243751Species Human (Homo sapiens) [TaxId:9606] [310972] (26 PDB entries)
  8. 2243775Domain d5db0a1: 5db0 A:2-230 [313324]
    Other proteins in same PDB: d5db0a2
    automated match to d4gpqa1

Details for d5db0a1

PDB Entry: 5db0 (more details)

PDB Description: menin in complex with mi-352
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d5db0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5db0a1 d.389.1.1 (A:2-230) Menin N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
glkaaqktlfplrsiddvvrlfaaelgreepdlvllslvlgfvehflavnrvgltyfpva
dlsiiaalyarftaqirgavdlslypreggvssrelvkkvsdviwnslsrsyfkdrahiq
slfsfitgtkldssgvafavvgacqalglrdvhlalsedhawvvfgpngeqtaevtwhgk
gnedrrgqtvnagvaerswlylkgsymrc

SCOPe Domain Coordinates for d5db0a1:

Click to download the PDB-style file with coordinates for d5db0a1.
(The format of our PDB-style files is described here.)

Timeline for d5db0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5db0a2