Lineage for d1qoza_ (1qoz A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311486Superfamily c.23.9: Cutinase-like [52259] (1 family) (S)
  5. 311487Family c.23.9.1: Cutinase-like [52260] (2 proteins)
    this family can be also classified into alpha/beta hydrolase superfamily
  6. 311488Protein Acetylxylan esterase [52263] (2 species)
  7. 311493Species Trichoderma reesei [TaxId:51453] [52265] (1 PDB entry)
  8. 311494Domain d1qoza_: 1qoz A: [31332]

Details for d1qoza_

PDB Entry: 1qoz (more details), 1.9 Å

PDB Description: catalytic core domain of acetyl xylan esterase from trichoderma reesei

SCOP Domain Sequences for d1qoza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qoza_ c.23.9.1 (A:) Acetylxylan esterase {Trichoderma reesei}
ecpaihvfgarettvsqgygssatvvnlviqahpgttseaivypacggqascggisyans
vvngtnaaaaainnfhnscpdtqlvlvgysqgaqifdnalcgggdpgegitntavpltag
avsavkaaifmgdprnihglpynvgtcttqgfdarpagfvcpsaskiksycdaadpycct
gndpnvhqgygqeygqqalafinsqls

SCOP Domain Coordinates for d1qoza_:

Click to download the PDB-style file with coordinates for d1qoza_.
(The format of our PDB-style files is described here.)

Timeline for d1qoza_: