Lineage for d1bs9__ (1bs9 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) Superfamily c.23.9: Cutinase-like [52259] (1 family) 
Family c.23.9.1: Cutinase-like [52260] (2 proteins) Protein Acetylxylan esterase [52263] (2 species) Species Penicillium purpurogenum [TaxId:28575] [52264] (3 PDB entries) 
Domain d1bs9__: 1bs9 - [31330]
Details for d1bs9__
PDB Entry: 1bs9 (more details), 1.1 Å
PDB Description: acetylxylan esterase from p. purpurogenum refined at 1.10 angstroms
SCOP Domain Sequences for d1bs9__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bs9__ c.23.9.1 (-) Acetylxylan esterase {Penicillium purpurogenum}
scpaihvfgarettaspgygssstvvngvlsaypgstaeainypacggqsscggasysss
vaqgiaavasavnsfnsqcpstkivlvgysqggeimdvalcgggdpnqgytntavqlsss
avnmvkaaifmgdpmfraglsyevgtcaaggfdqrpagfscpsaakiksycdasdpyccn
gsnaathqgygseygsqalafvksklg
SCOP Domain Coordinates for d1bs9__:
Click to download the PDB-style file with coordinates for d1bs9__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bs9__:
- d1bs9__ appears in SCOP 1.57
- d1bs9__ appears in the current release, SCOPe 2.08, called d1bs9a_
View in 3D