SCOP 1.67: Domain d1cudc_: 1cud C:

Lineage for d1cudc_ (1cud C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.30: Cutinase-like [52260] (2 proteins)
   minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold

6. Protein Cutinase [52261] (1 species)

7. Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)

8. Domain d1cudc_: 1cud C: [31328]
   mutant

Details for d1cudc_

PDB Entry: 1cud, 2.7 Å

PDB Description: cutinase, n172k, r196d mutant, monoclinic crystal form with three molecules per asymmetric unit

SCOP Domain Sequences for d1cudc_:

Sequence; same for both SEQRES and ATOM records:

>d1cudc_ c.69.1.30 (C:) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
gpapefliekvravrgs

Timeline for d1cudc_:

• d1cudc_ first appeared (with stable ids) in SCOP 1.55
  
• d1cudc_ appears in SCOP 1.65
  
• d1cudc_ appears in SCOP 1.69
  
• d1cudc_ appears in the current release, SCOPe 2.08