Lineage for d1cuwa_ (1cuw A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) Superfamily c.23.9: Cutinase-like [52259] (1 family) 
Family c.23.9.1: Cutinase-like [52260] (2 proteins) 
Protein Cutinase [52261] (1 species) Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries) 
Domain d1cuwa_: 1cuw A: [31324]
Details for d1cuwa_
PDB Entry: 1cuw (more details), 2.7 Å
PDB Description: cutinase, g82a, a85f, v184i, a185l, l189f mutant
SCOP Domain Sequences for d1cuwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cuwa_ c.23.9.1 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratladnflprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgsliilaphfaygpdar
gpapefliekvravrgs
SCOP Domain Coordinates for d1cuwa_:
Click to download the PDB-style file with coordinates for d1cuwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cuwa_:
- d1cuwa_ appears in SCOP 1.57
- d1cuwa_ appears in the current release, SCOPe 2.08
View in 3D
