SCOPe 2.08: Domain d1cuwa_: 1cuw A:

Lineage for d1cuwa_ (1cuw A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.30: Cutinase-like [52260] (3 proteins)
   minimal alpha/beta hydrolase lacking peripheral secondary structures; similar to a flavodoxin-like fold
   automatically mapped to Pfam PF01083

6. Protein Cutinase [52261] (1 species)

7. Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)

8. Domain d1cuwa_: 1cuw A: [31324]
   mutant

Details for d1cuwa_

PDB Entry: 1cuw, 2.7 Å

PDB Description: cutinase, g82a, a85f, v184i, a185l, l189f mutant

PDB Compounds: (A:) cutinase

SCOPe Domain Sequences for d1cuwa_:

Sequence; same for both SEQRES and ATOM records:

>d1cuwa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratladnflprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgsliilaphfaygpdar
gpapefliekvravrgs

Timeline for d1cuwa_:

• d1cuwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cuwa_ appears in SCOPe 2.07