Lineage for d1cue__ (1cue -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) Superfamily c.23.9: Cutinase-like [52259] (1 family) 
Family c.23.9.1: Cutinase-like [52260] (2 proteins) 
Protein Cutinase [52261] (1 species) Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries) 
Domain d1cue__: 1cue - [31322]
Details for d1cue__
PDB Entry: 1cue (more details), 2.7 Å
PDB Description: cutinase, q121l mutant
SCOP Domain Sequences for d1cue__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cue__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggyslgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs
SCOP Domain Coordinates for d1cue__:
Click to download the PDB-style file with coordinates for d1cue__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cue__:
- d1cue__ first appeared (with stable ids) in SCOP 1.55
- d1cue__ appears in SCOP 1.59
- d1cue__ appears in the current release, SCOPe 2.08, called d1cuea_
View in 3D