Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.9: Cutinase-like [52259] (1 family) |
Family c.23.9.1: Cutinase-like [52260] (2 proteins) this family can be also classified into alpha/beta hydrolase superfamily |
Protein Cutinase [52261] (1 species) |
Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries) |
Domain d1cua__: 1cua - [31313] mutant |
PDB Entry: 1cua (more details), 1.8 Å
SCOP Domain Sequences for d1cua__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cua__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi} rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdar gpapefliekvravrgs
Timeline for d1cua__: