Lineage for d5aekf_ (5aek F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (82 PDB entries)
  8. 2502754Domain d5aekf_: 5aek F: [313059]
    Other proteins in same PDB: d5aeka_, d5aekc_, d5aeke_, d5aekg_, d5aeki_, d5aekk_, d5aekm_, d5aeko_, d5aekq_, d5aeks_, d5aeku_, d5aekw_
    automated match to d2vrrb_

Details for d5aekf_

PDB Entry: 5aek (more details), 3 Å

PDB Description: crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
PDB Compounds: (F:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d5aekf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aekf_ d.15.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
lgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d5aekf_:

Click to download the PDB-style file with coordinates for d5aekf_.
(The format of our PDB-style files is described here.)

Timeline for d5aekf_: