Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (29 species) not a true protein |
Species Trichomonas vaginalis [TaxId:5722] [276012] (5 PDB entries) |
Domain d5a1tb2: 5a1t B:155-331 [313045] Other proteins in same PDB: d5a1ta1, d5a1tb1 automated match to d4uula2 complexed with nai, oxm |
PDB Entry: 5a1t (more details), 1.97 Å
SCOPe Domain Sequences for d5a1tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a1tb2 d.162.1.0 (B:155-331) automated matches {Trichomonas vaginalis [TaxId: 5722]} smldqnrayyevasklgvdvkdvhdiivwgnhgesmvadltqatftkegktqkvvdvldh dyvfdtffkkighrawdilehrgftsaasptkaaiqhmkawlfgtapgevlsmgipvpeg npygikpgvvfsfpcnvdkegkihvvegfkvndwlrekldftekdlfhekeialnhl
Timeline for d5a1tb2: