SCOP 1.65: Domain d1cub__: 1cub -

Lineage for d1cub__ (1cub -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.9: Cutinase-like [52259] (1 family)

5. Family c.23.9.1: Cutinase-like [52260] (2 proteins)
   this family can be also classified into alpha/beta hydrolase superfamily

6. Protein Cutinase [52261] (1 species)

7. Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)

8. Domain d1cub__: 1cub - [31304]
   mutant

Details for d1cub__

PDB Entry: 1cub, 1.75 Å

PDB Description: cutinase, n172k, r196d mutant, monoclinic crystal form

SCOP Domain Sequences for d1cub__:

Sequence; same for both SEQRES and ATOM records:

>d1cub__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargstetgnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcktgdlvctgslivaaphlaygpdae
gpapefliekvravrgs

Timeline for d1cub__:

• d1cub__ first appeared (with stable ids) in SCOP 1.55
  
• d1cub__ appears in SCOP 1.63
  
• d1cub__ appears in SCOP 1.67
  
• d1cub__ appears in the current release, SCOPe 2.08, called d1cuba_