Lineage for d5aj9b_ (5aj9 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2479285Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2479286Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2479408Family c.76.1.2: Arylsulfatase [53653] (4 proteins)
    includes additional C-terminal alpha+beta (sub)domain
  6. 2479427Protein automated matches [271610] (1 species)
    not a true protein
  7. 2479428Species Pseudomonas aeruginosa [TaxId:287] [271614] (6 PDB entries)
  8. 2479436Domain d5aj9b_: 5aj9 B: [312994]
    automated match to d4cysa_
    complexed with ca, cl, mes, so4; mutant

Details for d5aj9b_

PDB Entry: 5aj9 (more details), 2 Å

PDB Description: g7 mutant of pas, arylsulfatase from pseudomonas aeruginosa
PDB Compounds: (B:) arylsulfatase

SCOPe Domain Sequences for d5aj9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aj9b_ c.76.1.2 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
krpnflvivaddlgfsdigafggeiatpnldalaiaglrltdfhtasaxsptrsmlltgt
dhhiaglgtvaealtpelegkpgyeghlnervvalpellreagyqtlmagkwhlglkpeq
tphargfersfsllpgaanhygfeppydestprilkgtpalyvederyldtlpegfyssd
afgdkllqylkerdqsrpffaylpfsaphwplqapreivekyrgrydagpealrqerlar
lkelglveadveahpvlaltrewealedeeraksaramevyaamvermdwnigrvvdylr
rqgeldntfvlfmsdngaegalleafpkfgpdlldfldrhydnslenigsansyvwygpr
waqaatapsrlykafttqggirvpalvryprlsrqgaishafatvmdvtptlldlagvrh
pgkrwrgreiaeprgrswlgwlsgeteaahdentvtgwglfgmrairqgdwkavylpapv
gpatwqlydlardpgeihdladsqpgklaeliehwkryvsdtgvve

SCOPe Domain Coordinates for d5aj9b_:

Click to download the PDB-style file with coordinates for d5aj9b_.
(The format of our PDB-style files is described here.)

Timeline for d5aj9b_: