Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (40 species) not a true protein |
Species Mouse mammary tumor virus (strain br6) [TaxId:11758] [312889] (1 PDB entry) |
Domain d5cz2c_: 5cz2 C: [312967] automated match to d3l3ua_ complexed with mg, zn |
PDB Entry: 5cz2 (more details), 2.72 Å
SCOPe Domain Sequences for d5cz2c_:
Sequence, based on SEQRES records: (download)
>d5cz2c_ c.55.3.0 (C:) automated matches {Mouse mammary tumor virus (strain br6) [TaxId: 11758]} gvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs faymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqln klqkagkyytphhllahalfvlnhvnmdnqghtaaerhwg
>d5cz2c_ c.55.3.0 (C:) automated matches {Mouse mammary tumor virus (strain br6) [TaxId: 11758]} gvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs faymgipqkiktdnapayvsrsiqeflarwkishvtqaiverthqnikaqlnklqkagky ytphhllahalfvlnhvnmdnqghtaaerhwg
Timeline for d5cz2c_:
View in 3D Domains from other chains: (mouse over for more information) d5cz2a_, d5cz2b_, d5cz2d_, d5cz2e_ |