Lineage for d5cz2c_ (5cz2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887489Species Mouse mammary tumor virus (strain br6) [TaxId:11758] [312889] (1 PDB entry)
  8. 2887492Domain d5cz2c_: 5cz2 C: [312967]
    automated match to d3l3ua_
    complexed with mg, zn

Details for d5cz2c_

PDB Entry: 5cz2 (more details), 2.72 Å

PDB Description: crystal structure of a two-domain fragment of mmtv integrase
PDB Compounds: (C:) Pol polyprotein

SCOPe Domain Sequences for d5cz2c_:

Sequence, based on SEQRES records: (download)

>d5cz2c_ c.55.3.0 (C:) automated matches {Mouse mammary tumor virus (strain br6) [TaxId: 11758]}
gvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs
faymgipqkiktdnapayvsrsiqeflarwkishvtgipynpqgqaiverthqnikaqln
klqkagkyytphhllahalfvlnhvnmdnqghtaaerhwg

Sequence, based on observed residues (ATOM records): (download)

>d5cz2c_ c.55.3.0 (C:) automated matches {Mouse mammary tumor virus (strain br6) [TaxId: 11758]}
gvnprglkprvlwqmdvthvsefgklkyvhvtvdtyshftfatartgeatkdvlqhlaqs
faymgipqkiktdnapayvsrsiqeflarwkishvtqaiverthqnikaqlnklqkagky
ytphhllahalfvlnhvnmdnqghtaaerhwg

SCOPe Domain Coordinates for d5cz2c_:

Click to download the PDB-style file with coordinates for d5cz2c_.
(The format of our PDB-style files is described here.)

Timeline for d5cz2c_: