Lineage for d5ax8d_ (5ax8 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895545Protein automated matches [190317] (4 species)
    not a true protein
  7. 2895569Species Human (Homo sapiens) [TaxId:9606] [188901] (7 PDB entries)
  8. 2895587Domain d5ax8d_: 5ax8 D: [312965]
    automated match to d7aata_

Details for d5ax8d_

PDB Entry: 5ax8 (more details), 2.99 Å

PDB Description: recombinant expression, purification and preliminary crystallographic studies of the mature form of human mitochondrial aspartate aminotransferase
PDB Compounds: (D:) Aspartate aminotransferase, mitochondrial

SCOPe Domain Sequences for d5ax8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ax8d_ c.67.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sswwthvemgppdpilgvteafkrdtnskkmnlgvgayrddngkpyvlpsvrkaeaqiaa
knldkeylpigglaefckasaelalgensevlksgrfvtvqtisgtgalrigasflqrff
kfsrdvflpkptwgnhtpifrdagmqlqgyryydpktcgfdftgavediskipeqsvlll
hacahnptgvdprpeqwkeiatvvkkrnlfaffdmayqgfasgdgdkdawavrhfieqgi
nvclcqsyaknmglygervgaftmvckdadeakrvesqlkilirpmysnpplngariaaa
ilntpdlrkqwlqevkgmadriigmrtqlvsnlkkegsthnwqhitdqigmfcftglkpe
qverlikefsiymtkdgrisvagvtssnvgylahaihqvtk

SCOPe Domain Coordinates for d5ax8d_:

Click to download the PDB-style file with coordinates for d5ax8d_.
(The format of our PDB-style files is described here.)

Timeline for d5ax8d_: