Lineage for d5aooc_ (5aoo C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410774Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2410775Protein automated matches [190988] (15 species)
    not a true protein
  7. 2410776Species Aichivirus a [TaxId:72149] [312940] (1 PDB entry)
  8. 2410777Domain d5aooc_: 5aoo C: [312941]
    automated match to d1ncqc_

Details for d5aooc_

PDB Entry: 5aoo (more details), 2.1 Å

PDB Description: x-ray structure of a human kobuvirus: aichi virus a (aiv)
PDB Compounds: (C:) vp3

SCOPe Domain Sequences for d5aooc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aooc_ b.121.4.0 (C:) automated matches {Aichivirus a [TaxId: 72149]}
hwktravpgagtfgsavagqelplcgvrayyppnayipaqvrdwlefahrpglmatvpwt
madepaerlgifpvspsaiagtgapisyvislfsqwrgelaahllftgsaqhygrlvvcy
tpaapqppstmqeamrgtytvwdvnaastleftipfisnsywktvdvnnpdallsttgyv
siwvqnplvgphtapasalvqafisagesfnvrlmqnpal

SCOPe Domain Coordinates for d5aooc_:

Click to download the PDB-style file with coordinates for d5aooc_.
(The format of our PDB-style files is described here.)

Timeline for d5aooc_: