Lineage for d1xzg__ (1xzg -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177542Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 177936Superfamily c.23.9: Cutinase-like [52259] (1 family) (S)
  5. 177937Family c.23.9.1: Cutinase-like [52260] (2 proteins)
  6. 177946Protein Cutinase [52261] (1 species)
  7. 177947Species Fungus (Fusarium solani), subsp. pisi [TaxId:169388] [52262] (39 PDB entries)
  8. 177957Domain d1xzg__: 1xzg - [31292]

Details for d1xzg__

PDB Entry: 1xzg (more details), 1.69 Å

PDB Description: fusarium solani cutinase mutant with thr 45 replaced by ala

SCOP Domain Sequences for d1xzg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xzg__ c.23.9.1 (-) Cutinase {Fungus (Fusarium solani), subsp. pisi}
rttrddlingnsascadvifiyargsteagnlgtlgpsiasnlesafgkdgvwiqgvgga
yratlgdnalprgtssaairemlglfqqantkcpdatliaggysqgaalaaasiedldsa
irdkiagtvlfgytknlqnrgripnypadrtkvfcntgdlvctgslivaaphlaygpdar
gpapefliekvravrgs

SCOP Domain Coordinates for d1xzg__:

Click to download the PDB-style file with coordinates for d1xzg__.
(The format of our PDB-style files is described here.)

Timeline for d1xzg__: