Lineage for d5ce8c_ (5ce8 C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573070Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2573071Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2573190Family e.17.1.0: automated matches [191499] (1 protein)
    not a true family
  6. 2573191Protein automated matches [190815] (19 species)
    not a true protein
  7. 2573249Species Thermoproteus uzoniensis [TaxId:999630] [312849] (1 PDB entry)
  8. 2573252Domain d5ce8c_: 5ce8 C: [312900]
    Other proteins in same PDB: d5ce8a2, d5ce8b2
    automated match to d3u0gb_
    complexed with peg, plp

Details for d5ce8c_

PDB Entry: 5ce8 (more details), 2 Å

PDB Description: crystal structure of branched-chain aminotransferase from thermophilic archaea thermoproteus uzoniensis
PDB Compounds: (C:) branched-chain amino acid aminotransferase

SCOPe Domain Sequences for d5ce8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ce8c_ e.17.1.0 (C:) automated matches {Thermoproteus uzoniensis [TaxId: 999630]}
mkvwldgrlvdeeeakvtvlspslnygfgvfegiraywngenlyvfrlrdhmerllrsak
iigldvpytaeelskavvetvrangfkedlyirpvayiskpqisldvrglqasvaiaaip
fgkylkvegvraavvswrrvhtsmmpvmakatgiylnsimaavearargydeaimlnaeg
kvvegsgenifivrrgvlmtppledgilegitretvisiagdlgiplleksitreelyaa
deaffvgtaaeitpiieidgrvlqrgpitqkiaetyrrivlgkeekylpwltpvy

SCOPe Domain Coordinates for d5ce8c_:

Click to download the PDB-style file with coordinates for d5ce8c_.
(The format of our PDB-style files is described here.)

Timeline for d5ce8c_: