Lineage for d5c7jb_ (5c7j B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548233Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2548234Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2548250Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 2548251Protein automated matches [226939] (2 species)
    not a true protein
  7. 2548255Species Human (Homo sapiens) [TaxId:9606] [225255] (17 PDB entries)
  8. 2548275Domain d5c7jb_: 5c7j B: [312825]
    Other proteins in same PDB: d5c7jc1, d5c7jc2, d5c7jd1, d5c7jd2
    automated match to d2xbba_

Details for d5c7jb_

PDB Entry: 5c7j (more details), 3 Å

PDB Description: crystal structure of nedd4 with a ub variant
PDB Compounds: (B:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d5c7jb_:

Sequence, based on SEQRES records: (download)

>d5c7jb_ d.148.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefdg
ekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfig
rvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldlr
fiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffel
ipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdsek
rirllqfvtgtsrvpmngfaelygsngpqsftveqwgtpeklprahtcfnrldlppyesf
eelwdklqmaientqgf

Sequence, based on observed residues (ATOM records): (download)

>d5c7jb_ d.148.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdykrkyeffrrklkkqndipnkfemklrratvledsyrrimgvkradflkarlwiefdg
ekgldyggvarewffliskemfnpyyglfeysatdnytlqinpnsglcnedhlsyfkfig
rvagmavyhgklldgffirpfykmmlhkpitlhdmesvdseyynslrwilendpteldlr
fiideelfgqthqhelknggseivvtnknkkeyiylviqwrfvnriqkqmaafkegffel
ipqdlikifdenelellmcglgdvdvndwrehtkykngysanhqviqwfwkavlmmdsek
rirllqfvtgtsrvpmngfaelypqsftveqwgtpeklprahtcfnrldlppyesfeelw
dklqmaientqgf

SCOPe Domain Coordinates for d5c7jb_:

Click to download the PDB-style file with coordinates for d5c7jb_.
(The format of our PDB-style files is described here.)

Timeline for d5c7jb_: