Lineage for d5cojf_ (5coj F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904865Species Staphylococcus aureus [TaxId:1280] [187913] (4 PDB entries)
  8. 2904874Domain d5cojf_: 5coj F: [312815]
    Other proteins in same PDB: d5coja2, d5coje2
    automated match to d3hpda_
    complexed with mg, tze

Details for d5cojf_

PDB Entry: 5coj (more details), 1.9 Å

PDB Description: structure of hydroxyethylthiazole kinase thim from staphylococcus aureus in complex with native substrate 2-(4-methyl-1,3-thiazol-5- yl)ethanol.
PDB Compounds: (F:) hydroxyethylthiazole kinase

SCOPe Domain Sequences for d5cojf_:

Sequence, based on SEQRES records: (download)

>d5cojf_ c.72.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]}
nylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallinig
tltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnasei
laliddtatmkgtdsdanldavtiakkayaiyktaivitgkedvivqgdkaivlangspl
larvtgagcllggiiagflfretepdiealieavsvfniaaevaaenencggpgtfspll
ldtlyhlnettyqqri

Sequence, based on observed residues (ATOM records): (download)

>d5cojf_ c.72.1.0 (F:) automated matches {Staphylococcus aureus [TaxId: 1280]}
nylnnirienplticytndvvknftangllsigaspamseapeeaeefykvaqallinig
tltaqneqdiiaiaqtaneaglpivfdpvavgastyrkqfcklllksakvsvikgnasei
lalidavtiakkayaiyktaivitgkedvivqgdkaivlangspllarvtgagcllggii
agflfretepdiealieavsvfniaaevaaenencggpgtfspllldtlyhlnettyqqr
i

SCOPe Domain Coordinates for d5cojf_:

Click to download the PDB-style file with coordinates for d5cojf_.
(The format of our PDB-style files is described here.)

Timeline for d5cojf_: