Lineage for d5c7mb_ (5c7m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931514Protein Ubiquitin [54238] (9 species)
  7. 2931628Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries)
    Uniprot P62988
    identical sequence in many other species
  8. 2932187Domain d5c7mb_: 5c7m B: [312762]
    Other proteins in same PDB: d5c7ma_
    automated match to d3rula_

Details for d5c7mb_

PDB Entry: 5c7m (more details), 3.03 Å

PDB Description: crystal structure of e3 ligase itch with a ub variant
PDB Compounds: (B:) Polyubiquitin-C

SCOPe Domain Sequences for d5c7mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7mb_ d.15.1.1 (B:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]}
mhilvktlrgktitlevepsdtienvkakiqdkegippdqqrllfggnkledgrtlsdyn
iqkesnlylllrr

SCOPe Domain Coordinates for d5c7mb_:

Click to download the PDB-style file with coordinates for d5c7mb_.
(The format of our PDB-style files is described here.)

Timeline for d5c7mb_: