SCOPe 2.06: Domain d5c9ja1: 5c9j A:9-187

Lineage for d5c9ja1 (5c9j A:9-187)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)

8. Domain d5c9ja1: 5c9j A:9-187 [312752]
   Other proteins in same PDB: d5c9ja2, d5c9ja3, d5c9jb1, d5c9jb2
   automated match to d3s6ca2
   complexed with dao, gol, po4, ste

Details for d5c9ja1

PDB Entry: 5c9j, 2.4 Å

PDB Description: human cd1c with ligands in a' and f' channel

PDB Compounds: (A:) T-cell surface glycoprotein CD1c,T-cell surface glycoprotein CD1b

SCOPe Domain Sequences for d5c9ja1:

Sequence; same for both SEQRES and ATOM records:

>d5c9ja1 d.19.1.0 (A:9-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhnwskgnfsneelsd
lellfrfylfgltreiqdhasqdyskypfevqvkagcelhsgkspegffqvafngldlls
fqnttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

Timeline for d5c9ja1:

• d5c9ja1 is new in SCOPe 2.06-stable
  
• d5c9ja1 appears in SCOPe 2.07
  
• d5c9ja1 appears in the current release, SCOPe 2.08