Lineage for d5c9ja1 (5c9j A:9-187)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507544Species Human (Homo sapiens) [TaxId:9606] [226044] (76 PDB entries)
  8. 2507626Domain d5c9ja1: 5c9j A:9-187 [312752]
    Other proteins in same PDB: d5c9ja2, d5c9ja3, d5c9jb1, d5c9jb2
    automated match to d3s6ca2
    complexed with dao, gol, po4, ste

Details for d5c9ja1

PDB Entry: 5c9j (more details), 2.4 Å

PDB Description: human cd1c with ligands in a' and f' channel
PDB Compounds: (A:) T-cell surface glycoprotein CD1c,T-cell surface glycoprotein CD1b

SCOPe Domain Sequences for d5c9ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c9ja1 d.19.1.0 (A:9-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ehvsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhnwskgnfsneelsd
lellfrfylfgltreiqdhasqdyskypfevqvkagcelhsgkspegffqvafngldlls
fqnttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

SCOPe Domain Coordinates for d5c9ja1:

Click to download the PDB-style file with coordinates for d5c9ja1.
(The format of our PDB-style files is described here.)

Timeline for d5c9ja1: