Lineage for d5c1pc2 (5c1p C:97-306)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217819Species Yersinia pestis [TaxId:632] [280584] (5 PDB entries)
  8. 2217834Domain d5c1pc2: 5c1p C:97-306 [312750]
    Other proteins in same PDB: d5c1pa1, d5c1pb1, d5c1pc1, d5c1pd1
    automated match to d1iova2
    complexed with act, adp, dal, gol, na

Details for d5c1pc2

PDB Entry: 5c1p (more details), 2.4 Å

PDB Description: crystal structure of adp and d-alanyl-d-alanine complexed d-alanine-d- alanine ligase(ddl) from yersinia pestis
PDB Compounds: (C:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d5c1pc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c1pc2 d.142.1.0 (C:97-306) automated matches {Yersinia pestis [TaxId: 632]}
klrtklvwqalglpispyvalnrqqfetlspeelvacvaklglplivkpshegssvgmsk
vdhaselqkalveafqhdsdvliekwlsgpeftvailgdevlpsiriqppgvfydydaky
lsdktqyfcpsglsdeseqqlaalalqayhaldcsgwgrvdvmqdrdghfyllevntspg
mtshslvpmaarqyglsfsqlvarilmlad

SCOPe Domain Coordinates for d5c1pc2:

Click to download the PDB-style file with coordinates for d5c1pc2.
(The format of our PDB-style files is described here.)

Timeline for d5c1pc2: