Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.4: Ornithine decarboxylase N-terminal "wing" domain [52252] (1 protein) automatically mapped to Pfam PF03709 |
Protein Ornithine decarboxylase N-terminal "wing" domain [52253] (1 species) |
Species Lactobacillus sp., strain 30a [TaxId:1591] [52254] (2 PDB entries) |
Domain d1orda1: 1ord A:1-107 [31274] Other proteins in same PDB: d1orda2, d1orda3, d1ordb2, d1ordb3 complexed with plp |
PDB Entry: 1ord (more details), 3 Å
SCOPe Domain Sequences for d1orda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orda1 c.23.1.4 (A:1-107) Ornithine decarboxylase N-terminal "wing" domain {Lactobacillus sp., strain 30a [TaxId: 1591]} ssslkiastqearqyfdtdrvvvdavgsdftdvgaviamdyetdvidaadatkfgipvfa vtkdaqaisadelkkifhiidlenkfdatvnareietavnnyedsil
Timeline for d1orda1: