Lineage for d5ay7a_ (5ay7 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095302Species Aegilops speltoides [TaxId:58531] [312722] (1 PDB entry)
  8. 2095303Domain d5ay7a_: 5ay7 A: [312723]
    automated match to d2depb_

Details for d5ay7a_

PDB Entry: 5ay7 (more details), 2.15 Å

PDB Description: a psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d5ay7a_:

Sequence, based on SEQRES records: (download)

>d5ay7a_ c.1.8.0 (A:) automated matches {Aegilops speltoides [TaxId: 58531]}
glkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnweda
dkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeefyanmkhhiqaivnrykd
vvycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndyn
daepaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihlt
eldirinedmggglrfnqgqatvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdk
dswlgvrnypllfdenykpkqaynavknfd

Sequence, based on observed residues (ATOM records): (download)

>d5ay7a_ c.1.8.0 (A:) automated matches {Aegilops speltoides [TaxId: 58531]}
glkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnweda
dkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeefyanmkhhiqaivnrykd
vvycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndyn
daepaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihlt
eldirinvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdkdswlgvrnypllfde
nykpkqaynavknfd

SCOPe Domain Coordinates for d5ay7a_:

Click to download the PDB-style file with coordinates for d5ay7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ay7a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5ay7b_